SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339328685|ref|YP_004688377.1|NC_015727 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339328685|ref|YP_004688377.1|NC_015727
Domain Number 1 Region: 36-270
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.22e-36
Family Hydroxynitrile lyase-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|339328685|ref|YP_004688377.1|NC_015727
Sequence length 291
Comment alpha/beta hydrolase [Cupriavidus necator N-1 plasmid pBB1]
Sequence
MKAEDAEMGMRHAIGADALMTASPRDDCVARRKSQAKAHFVLVHGAWHGAWCWSKVIPHL
RARGHGVTAVDLPGRWRDPKELVALTADDYVNAVEQVLLTVHDPIVLVGHSLGGATISLA
AERRPDRVRLLVYLAAFLVPNGQTVRSVADADNRSSVPLLVHREMGVSYINHDLANEVLY
HDCGEADTQVAHKLLCPEPSTVMLAPIKVTPERFGRVDRAYVECLQDRAISIDAQRAMQA
AQPCRQVVTMDASHSPFLSQPSEVADILVRLSVGIPCSKECRSGSNVDVRG
Download sequence
Identical sequences F8GUD5
gi|339328685|ref|YP_004688377.1| WP_013959371.1.32076 gi|339328685|ref|YP_004688377.1|NC_015727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]