SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|357408669|ref|YP_004920592.1|NC_016113 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357408669|ref|YP_004920592.1|NC_016113
Domain Number 1 Region: 3-226
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000000341
Family Hydroxynitrile lyase-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|357408669|ref|YP_004920592.1|NC_016113
Sequence length 232
Comment hypothetical protein SCAT_p1304 [Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT]
Sequence
MEPVFVLIHSPSVGPSTWQPVAERLRAAGRRVRVPSLARAGAGAPPFWPRAVEAVRDGLG
DVPADQPLVLVAHSNAGLFLPAVRAGLDHPVAGSVFVDAALPARTGPTPVAPPELLDFLR
PLAVDGVLPRWTDWYDEADVAPMFPDPATRKAVEAEEPALPLSYYQQRIPVPVGWDDHPC
SYLLFGPPYDGLADEARARGWRVGHLPGAHLHQLVDPDGTAGHILRLTAGHG
Download sequence
Identical sequences F8JJW1
gi|357408669|ref|YP_004920592.1|NC_016113 gi|386352319|ref|YP_006050566.1|NC_017585 gi|386352319|ref|YP_006050566.1| gi|357408669|ref|YP_004920592.1| WP_014151751.1.28582 WP_014151751.1.70206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]