SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|357408921|ref|YP_004920844.1|NC_016113 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357408921|ref|YP_004920844.1|NC_016113
Domain Number 1 Region: 8-117
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000000133
Family Carboxylesterase 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|357408921|ref|YP_004920844.1|NC_016113
Sequence length 166
Comment hypothetical protein SCAT_p1556 [Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT]
Sequence
MEPTVPDSRMFMGAPVGTRWCRQGARWSPGWPASSRGRRSPRVLGCVLAEGVCKEAAQDG
VGEAPDRDPLRDEGNRYAMRLPAAGVPVELRPVPGMFHVFDHVAPDAGMAAALVRALCRH
RREPASPRRARAPFGTLARVGKPGRVVSRSGPERRVAGGWHGVLRP
Download sequence
Identical sequences gi|357408921|ref|YP_004920844.1| gi|357408921|ref|YP_004920844.1|NC_016113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]