SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375006537|ref|YP_004975321.1|NC_016587 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375006537|ref|YP_004975321.1|NC_016587
Domain Number 1 Region: 2-223
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.77e-33
Family Hydroxynitrile lyase-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|375006537|ref|YP_004975321.1|NC_016587
Sequence length 229
Comment hypothetical protein AZOLI_p40358 [Azospirillum lipoferum 4B plasmid AZO_p4]
Sequence
MSSTPTIILVHGAFADGSSWNRVIPRLQAEGLAAVAVQNPLVSLDDDVAHVQRAIDRTKG
PVLLVGHSWGGAVITQIGDQERVKALVYVAAFAPDAGQSPNDTLKPFPPSAGLSGVSVDK
GRFLTLTPEGMARNFAQDLAPEEAALLAATQGPVAAACFATRVSAAAWKAKPAWYIVATQ
DRMLPPDFLRATAGRIGARTVEVESGHAPHLSHPDAVAAVIVEAARAAV
Download sequence
Identical sequences G7ZG53
gi|375006537|ref|YP_004975321.1| gi|375006537|ref|YP_004975321.1|NC_016587 WP_014189592.1.44154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]