SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|376258499|ref|YP_005150221.1|NC_016792 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|376258499|ref|YP_005150221.1|NC_016792
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.93e-25
Family Epoxide hydrolase 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|376258499|ref|YP_005150221.1|NC_016792
Sequence length 145
Comment hypothetical protein BCN_P201 [Bacillus cereus NC7401 plasmid pNCcld]
Sequence
MAKEMFVQISDCKLYAKLIGENNGKPTIIMDAGYGDFSKAWDSVIGDISMLSNVLIYDRA
GLGKSETSSNPRTSREMVKELKELLIEANIKPPYILVGHSFGGVNMRIYATEYHNEVCGL
VLVDSTPEDYRERFLPTQILAIGVR
Download sequence
Identical sequences A1BYY3 B7I0R5
gi|190015660|ref|YP_001967335.1|NC_010924 gi|217956860|ref|YP_002335954.1|NC_011655 gi|376258499|ref|YP_005150221.1|NC_016792 WP_002163388.1.18840 WP_002163388.1.24377 WP_002163388.1.26499 WP_002163388.1.27334 WP_002163388.1.32522 WP_002163388.1.33061 WP_002163388.1.43762 WP_002163388.1.47097 WP_002163388.1.48311 WP_002163388.1.48599 WP_002163388.1.51087 WP_002163388.1.52756 WP_002163388.1.55057 WP_002163388.1.59773 WP_002163388.1.79658 WP_002163388.1.82986 WP_002163388.1.8923 405534.BCAH187_C0219 gi|217956860|ref|YP_002335954.1| gi|376258499|ref|YP_005150221.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]