SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|378764600|ref|YP_005193216.1|NC_016815 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378764600|ref|YP_005193216.1|NC_016815
Domain Number 1 Region: 11-267
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.77e-54
Family Carbon-carbon bond hydrolase 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378764600|ref|YP_005193216.1|NC_016815
Sequence length 272
Comment putative hydrolase [Sinorhizobium fredii HH103 plasmid pSfHH103e]
Sequence
MCSVKDEWHRRKRRIELPGGRPIAFVDSGGSGPPLLLLHGYSDTGRSFAALEPFLAGYRL
IIPDLPGHGESALGDGMRVSDFAASIDGFRAFLRISKFAVIGHSMGAMTAIELAARRRDD
VIALVLMSASLRPDFGSRSPLSRGIRALRDPIDPAGHFLRDWYSCSRPVEPDFLSKMKRD
AAAMPAAVWHGILEGFAETDLRRSAMRVTTPVLCIGGSADPLFGTPHREALAQAFPSVRS
TTLDGYGHNPHWEDPQRVSALMLSFLAEARMV
Download sequence
Identical sequences G9AJ45
WP_014332708.1.24350 gi|378764600|ref|YP_005193216.1|NC_016815 gi|378764600|ref|YP_005193216.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]