SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383760779|ref|YP_005439762.1|NC_017078 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383760779|ref|YP_005439762.1|NC_017078
Domain Number 1 Region: 28-83
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000141
Family Haloperoxidase 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383760779|ref|YP_005439762.1|NC_017078
Sequence length 97
Comment hypothetical protein SELR_pSRC100910 [Selenomonas ruminantium subsp. lactilytica TAM6421 plasmid pSRC1]
Sequence
MGQCAEAELEAQGVIHTEFGEDLSWEYLSYVRNHPIKWNVPTQILYGEKDQLTSLATMKD
FAEKHHAGLTVMENGEHWFHTEEQMAFLDDWIFVTKF
Download sequence
Identical sequences I0GVW1
gi|383760779|ref|YP_005439762.1| gi|383760779|ref|YP_005439762.1|NC_017078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]