SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384538978|ref|YP_005723062.1|NC_017326 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384538978|ref|YP_005723062.1|NC_017326
Domain Number 1 Region: 6-199
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.53e-42
Family Carboxylesterase/thioesterase 1 0.000000568
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384538978|ref|YP_005723062.1|NC_017326
Sequence length 200
Comment putative esteraselipase/thioesterase protein [Sinorhizobium meliloti SM11 plasmid pSmeSM11d]
Sequence
MVDHGYVHKLKPGMPGAPILFVLHGTGGDENQFFGFGAQLLPEATVVSPRGDVSEHGAAR
FFRRTGEGVYDMADLARATEKMAGFVKALAGEHDASEIIGLGYSNGANILANVLIEEGVF
EKAVLMHPLIPFRPRDNPALAGRKILITAGERDPICPAPMTQALGDYYTMQKATVEFEWH
SGGHDIRQNEIGAIEAFLKA
Download sequence
Identical sequences F7XG85
gi|384538978|ref|YP_005723062.1| WP_014530431.1.48083 WP_014530431.1.83536 gi|384538978|ref|YP_005723062.1|NC_017326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]