SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384540276|ref|YP_005724359.1|NC_017327 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384540276|ref|YP_005724359.1|NC_017327
Domain Number 1 Region: 21-89
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000000885
Family Haloperoxidase 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384540276|ref|YP_005724359.1|NC_017327
Sequence length 95
Comment hypothetical protein SM11_pC0477 [Sinorhizobium meliloti SM11 plasmid pSmeSM11c]
Sequence
MLVVNGMTSRAVNEGFVRTATIDLEPVFAAYAGPILLTHGVHDRLVRVAMSERIKAIHKN
SRLSLYDNSGHSPFYEEPARYGQELAAFVKAANGD
Download sequence
Identical sequences F7XD71
gi|384540276|ref|YP_005724359.1| gi|384540276|ref|YP_005724359.1|NC_017327 WP_014531255.1.21755 WP_014531255.1.30341 WP_014531255.1.48083 WP_014531255.1.49828 WP_014531255.1.50755 WP_014531255.1.80755 WP_014531255.1.99158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]