SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384541275|ref|YP_005725358.1|NC_017327 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384541275|ref|YP_005725358.1|NC_017327
Domain Number 1 Region: 3-120
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000682
Family Fungal lipases 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384541275|ref|YP_005725358.1|NC_017327
Sequence length 144
Comment hypothetical protein SM11_pC1476 [Sinorhizobium meliloti SM11 plasmid pSmeSM11c]
Sequence
MTKVTVIAHSLGAPVSRRALLDAIRNQASWAGKTRLQLFAPAHMGAYLNKVRKELGIASR
LIASLTALTKFGVLSLDGLEPGSPFLTQLMEDSSKELANGWDAQVKARQVFLGMGKMWSW
CSASWRILRTPSGPGWTLLRPPLR
Download sequence
Identical sequences F7XBW2
gi|384541275|ref|YP_005725358.1|NC_017327 gi|384541275|ref|YP_005725358.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]