SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386335786|ref|YP_006031956.1|NC_017575 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386335786|ref|YP_006031956.1|NC_017575
Domain Number 1 Region: 17-265
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.68e-41
Family Carbon-carbon bond hydrolase 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386335786|ref|YP_006031956.1|NC_017575
Sequence length 272
Comment b-ketoadipate enol-lactone hydrolase protein [Ralstonia solanacearum Po82 plasmid megaplasmid]
Sequence
MRAQGEFADVRLPLVVDGTALDIAALHRPGDRAPILFLHGFGSTKEDYADIGRHAAFDGR
PCIAYDAPGCGETRCADLARISIPFLVGTAAAVLDHFGIRTFHLVGHSMGGLTALMLASQ
WPDRVLSFTDIEGNLAPEDCFLSRQIVDYPEADAERFFDGFIERTRHAPAYASALYAASL
RHKVRAGAVRGIFESMVDLSDNGDLMARFLGLPCPKLFMYGEQNASLSYLRHIRAHGVEL
AEIPACGHFPMYSNPVLMWERIAGFQAGACTG
Download sequence
Identical sequences F6G8Y0
gi|386335786|ref|YP_006031956.1| gi|386335786|ref|YP_006031956.1|NC_017575 WP_014619041.1.26825 WP_014619041.1.34773 WP_014619041.1.55536 WP_014619041.1.58565 WP_014619041.1.63712 WP_014619041.1.80654 WP_014619041.1.85801 WP_014619041.1.88780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]