SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386353374|ref|YP_006051621.1|NC_017585 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386353374|ref|YP_006051621.1|NC_017585
Domain Number 1 Region: 4-257
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.9e-61
Family Haloperoxidase 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386353374|ref|YP_006051621.1|NC_017585
Sequence length 260
Comment hydrolase or acyltransferase (alpha/beta hydrolase superfamily)-like protein [Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT]
Sequence
MEYTTTHDGVRIAYDVQGDGASTLVLLAGQANSHRWWDGVRDDFHGVRRTVALDYRGTGE
SDKPDTPYSTEVFARDVIAVLDALGVDRADVYGTSMGGRVAQQLAARHPDRVGALVLGCT
SPGGPHGVERGDDVRKSLARPQPQARRALLELMYTPDWLATRPGPYHTLGDPGMPAHARR
RHLAASDRHDTWDLLPGITAPTLVLHGSDDLLNPTANALLLAHRIPGARLHLIPGARHAY
FEEFRSVASPLVLDFLATVP
Download sequence
Identical sequences F8JKX6
gi|386353374|ref|YP_006051621.1| gi|357407636|ref|YP_004919559.1| WP_014150722.1.28582 WP_014150722.1.70206 gi|357407636|ref|YP_004919559.1|NC_016113 gi|386353374|ref|YP_006051621.1|NC_017585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]