SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|38639564|ref|NP_943333.1|NC_005249 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38639564|ref|NP_943333.1|NC_005249
Domain Number 1 Region: 13-140,181-287
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.51e-47
Family Atu1826-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|38639564|ref|NP_943333.1|NC_005249
Sequence length 287
Comment hypothetical protein LV077 [Klebsiella pneumoniae CG43 plasmid pLVPK]
Sequence
MMEISTQKLSDGIVLTLRSPSDSTKSPVIILCHGFCGIREILLPDFAEAFTRAGFSTITF
DYRGFGDSDGERGRLVPAMQIDDIISVVNWAREQPSLDAQRIGLWGTSFGGCHVFGAAVR
DPGIKCIVSQLAFADGEEIVTGNMNNEEKEAFLSTLDKMAEKQKNTGKEMFVGVNRVLSD
AESKSFFEENRTQYPKMDIKIPFLTVRETLLYKPALNASQVMCPTLIVIAGQDTVNPPEQ
GRALFDAVGAKEKRLYEESSARHYDIYAGEHFKQVISIQTEWFKTHL
Download sequence
Identical sequences Q6U638 R4Y3G8
gi|38639564|ref|NP_943333.1|NC_005249 gi|529974917|ref|YP_007988893.1|NC_021231 gi|529974917|ref|YP_007988893.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]