SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386854820|ref|YP_006262560.1|NC_017791 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386854820|ref|YP_006262560.1|NC_017791
Domain Number 1 Region: 1-173
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.31e-17
Family Carbon-carbon bond hydrolase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386854820|ref|YP_006262560.1|NC_017791
Sequence length 189
Comment Alpha/beta hydrolase fold protein [Deinococcus gobiensis I-0 plasmid P2]
Sequence
MGARLVLELVRRGGVLGAVVSLDPGGFWQGWERSFFYNTVAASITLIRALQPAMPALTAS
PVTRSVLFAQFSSHPWALSPELTLTEMRSFAASPSTDELLRNLAYGEAQQGMPRGQLAHP
LVIGWGRWDRVCVPAQAARAQALFPDARLHWFDHSGHFPHWDMPTQTLQLILNTTADSGN
LEVKDRTKV
Download sequence
Identical sequences H8H1T8
gi|386854820|ref|YP_006262560.1|NC_017791 gi|386854820|ref|YP_006262560.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]