SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386858289|ref|YP_006271471.1|NC_017805 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386858289|ref|YP_006271471.1|NC_017805
Domain Number 1 Region: 10-202
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.58e-43
Family Carboxylesterase/thioesterase 1 0.0000721
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386858289|ref|YP_006271471.1|NC_017805
Sequence length 207
Comment Esterase/lipase/thioesterase, active site protein [Deinococcus gobiensis I-0 plasmid P1]
Sequence
MTTPTPDLSWIHLLERGTQDRTLLLLHGTGGDERSLLDLGRRLAPGAGLLSVRGRSLEEG
FPRFFRRFSAIQYDQPHLNAEADALADFTAQAAAHYGLNPAKITALGYSNGANIALATLV
RRPGIFAGAALLRPVMALENPPHPDLGGVRVLALHGARDPFLPHAAALGPYLRGLGADLT
EQTVNAGHELSPQDLNLTAAWLGAGQP
Download sequence
Identical sequences H8H0R7
gi|386858289|ref|YP_006271471.1|NC_017805 gi|386858289|ref|YP_006271471.1| WP_014695454.1.15941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]