SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389874608|ref|YP_006373964.1|NC_017958 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389874608|ref|YP_006373964.1|NC_017958
Domain Number 1 Region: 13-218
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000000000000174
Family Dienelactone hydrolase 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389874608|ref|YP_006373964.1|NC_017958
Sequence length 270
Comment dienelactone hydrolase family protein [Tistrella mobilis KA081020-065 plasmid pTM3]
Sequence
MHALDQDDDLADFEPREITIDDVTRRVRVAGQGPGVIVMTEMPGISPEVARFARWVRDAG
FTVWMPSLFGRDGAVPEADEGAAIFRRTCIAATFRAVATGGPGAVTAWLRGLARIAHQAC
GGPGVGAIGMCFTGNYALSMMLEPAVLAPVLCQPSLPLDAPAAIESPPEELAAVRARLDR
ENLTVLAYRFAGDAVCRAERFAAYERALGNRFQPRTLPDTAARREGLSPFFARHVPTPHS
VVTAHLIDEAGQPTLAARDEILAFFADRLA
Download sequence
Identical sequences I3TW44
gi|389874608|ref|YP_006373964.1| WP_014747971.1.78709 gi|389874608|ref|YP_006373964.1|NC_017958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]