SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392380310|ref|YP_004987468.1|NC_016596 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392380310|ref|YP_004987468.1|NC_016596
Domain Number 1 Region: 12-266
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.11e-49
Family Haloperoxidase 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392380310|ref|YP_004987468.1|NC_016596
Sequence length 269
Comment putative alpha/beta hydrolase fold [Azospirillum brasilense Sp245 plasmid AZOBR_p4]
Sequence
MTSSTHRYGANVRGNGIRQHYLRYGGEGRPVVIVPGITSPAVTWGFVAERFGRNFDTYVL
DVRGRGLSEASDALDYGLDAMAADVTAFAEALGLRDYALVGHSMGARIGLRAVSRHGAAP
ARLVMVDPPVSGPGRRPYPAQLPWYVDSIRLMREGADLEAMRPFCPTWTDAQLRLRAEWL
HTCDERAIVTAFNDFQTDDIHADFPRIPCPALLIAAGRGDVIRPEEEAEIRRLQPELAVT
RVEGAGHMIPWDDEEGFYRAFGTFLGTAV
Download sequence
Identical sequences G8B0I6
WP_014200184.1.1190 gi|392380310|ref|YP_004987468.1|NC_016596 gi|392380310|ref|YP_004987468.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]