SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407723327|ref|YP_006842988.1|NC_018701 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407723327|ref|YP_006842988.1|NC_018701
Domain Number 1 Region: 38-235
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 9.62e-31
Family Lipase 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407723327|ref|YP_006842988.1|NC_018701
Sequence length 243
Comment phospholipase/carboxylesterase [Sinorhizobium meliloti Rm41 plasmid pSYMB]
Sequence
MTRNIMALAFTALIGMCSAGVAHAEQLAARSSTSIKNDLNYLIYTPNDYASSSNAYPLVV
WLHGGDQGGTDIEKVRSSGIPKLIEEGKKFPFLVFSPQNPSEELLYPIEKVEAALAEVMW
KYRVDRARVYVVGFSRGAFAAWAMAEQFPETFAAVVPIAGGGNRHYLSRTNEKAAFWVFH
GTNDEVIPLSDSVVLYERLVGLKRNARLTVLEGVDHSSVERAALNDPELWDWLLKQRLEV
APE
Download sequence
Identical sequences gi|407723327|ref|YP_006842988.1|NC_018701 gi|334320667|ref|YP_004557296.1| WP_013850642.1.3038 WP_013850642.1.34728 WP_013850642.1.36292 WP_013850642.1.44594 WP_013850642.1.49828 WP_013850642.1.80755 WP_013850642.1.96031 gi|407723327|ref|YP_006842988.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]