SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|410689275|ref|YP_006962879.1|NC_019313 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410689275|ref|YP_006962879.1|NC_019313
Domain Number 1 Region: 5-149
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.11e-16
Family Carboxylesterase/thioesterase 1 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|410689275|ref|YP_006962879.1|NC_019313
Sequence length 153
Comment hypothetical protein [Sinorhizobium meliloti plasmid pHRC017]
Sequence
MDGEGFTFFKRRSDRSIPPEELMALARESISANGFVLACGLKDMLVVGYSSGAIFGTALL
ALAPENFVGAILLRPQPISDDFTFPELSGKPVLIISGLRDNRREPQHASQVAEQLIAAIA
VVTHHALDSGHGWAANDDDLVLARPWMDENFPT
Download sequence
Identical sequences I2E239
gi|410689275|ref|YP_006962879.1|NC_019313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]