SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|433644666|ref|YP_007277234.1|NC_019958 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|433644666|ref|YP_007277234.1|NC_019958
Domain Number - Region: 31-107
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0144
Family Ccg1/TafII250-interacting factor B (Cib) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|433644666|ref|YP_007277234.1|NC_019958
Sequence length 138
Comment hypothetical protein Mycsm_07107 [Mycobacterium smegmatis JS623 plasmid pMYCSM02]
Sequence
MADEGHRHGIAAVEVSHYERFHQDMSLYRCTIAHDGANRQIIVHWDDNDPNRHIVAPTTI
PASETTEERLAHELGRMGFRVVSIDSDNVGRGWAVVAHARSDWPFYNPLTEGWFAYLDDA
AIRGIRARWPEAVVPGVR
Download sequence
Identical sequences L0J7G7
gi|433644666|ref|YP_007277234.1| WP_015298100.1.84251 gi|433644666|ref|YP_007277234.1|NC_019958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]