SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|440223343|ref|YP_007336739.1|NC_020062 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|440223343|ref|YP_007336739.1|NC_020062
Domain Number 1 Region: 32-284
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.13e-37
Family Carboxylesterase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|440223343|ref|YP_007336739.1|NC_020062
Sequence length 293
Comment alpha/beta hydrolase fold-3 [Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c]
Sequence
MMGIVTRHIVLGAMLCCLVTASSAHEAAPYVRTEVRYSSQSALQKFDLYMPTQGSGPFPV
VMWIHGGNFYGGDKSHMPHVDRDPIPTQPNERPYQEQVPDVASLTRMGYAVISLNYRLGG
PDWATAMLNGIRDGKMAVRYLHSNAGALRIDPTRIAVWGNSAGGFIATALGLTGDQPSPF
DDGASPNLSSDVRAVIVWFGAENGKSRPILQLEPYIGSAKIVPPFLIVNGELDDIVTPED
ARRLHDALISHGASSTLTIVKGAGHEDPLFMKTQMQPAFDFLQRALLPDNTLR
Download sequence
Identical sequences L0LSB8
WP_015342418.1.25425 gi|440223343|ref|YP_007336739.1| gi|440223343|ref|YP_007336739.1|NC_020062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]