SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|452196214|ref|YP_007492239.1|NC_020394 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452196214|ref|YP_007492239.1|NC_020394
Domain Number 1 Region: 10-236
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.33e-44
Family Hypothetical protein VC1974 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|452196214|ref|YP_007492239.1|NC_020394
Sequence length 243
Comment surfactin production and competence [Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-233]
Sequence
MRKLMKDLSPGLKSNKYLVCVPYAGGYSNSFLPLKNYLPKDIKLISFDPPGHGPNLSPLV
DNIDDLVNLYLMEMQPILEGEVTLFGHSMGGIIVHRMAQILESKGINPKNVIISAMNPPE
IRRKTNHLDDKDFIDYIKSLGGLPDEVLQHQELLNYILPVIRSDFRAIENYINDDTTLLK
APLYIISGTTDSNYTVKGAKKWVEWGNEVHFLTVNGGHMFLLHQADIVGELIMKILDRVK
SVK
Download sequence
Identical sequences A0A0F6J0B2 M1PVX2
gi|452196214|ref|YP_007492239.1|NC_020394 gi|452196214|ref|YP_007492239.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]