SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|490061304|ref|WP_003963551.1|NZ_CM000914 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|490061304|ref|WP_003963551.1|NZ_CM000914
Domain Number 1 Region: 24-275
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.09e-36
Family Haloalkane dehalogenase 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|490061304|ref|WP_003963551.1|NZ_CM000914
Sequence length 282
Comment oxidoreductase [Streptomyces clavuligerus ATCC 27064 plasmid pSCL4]
Sequence
MCPAGRGGSVTSSGHSVVSALRARRRAFDHYGEGLLMPAILIHGVPDTHHVWDGVRRRLT
RTDVEAWDLPGFGTPRPDGFGSTKEEYVDWLVERLERVGEPVDLVGHDWGCILTLRVACL
RPDLVRTWAGGDGPLDAGYEWHPLAKIWQDPVEGDRYMAELEPESFTHGLVGGFDVPADR
AAEMIGRVDGTMKDSILRLYRSALTVGAEWAPELSRVAAPCLVFWGVRDPACPVGFADGL
AAALRAPDPVRIDSNHWPLLERPAEVAAALEAHWDTAADLGG
Download sequence
Identical sequences D5SLC0
gi|490061304|ref|WP_003963551.1|NZ_CM000914 WP_003963551.1.11688 WP_003963551.1.2818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]