SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|494073921|ref|WP_007015978.1|NZ_AGFM01000122 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|494073921|ref|WP_007015978.1|NZ_AGFM01000122
Domain Number 1 Region: 8-278
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.53e-62
Family Carbon-carbon bond hydrolase 0.00000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|494073921|ref|WP_007015978.1|NZ_AGFM01000122
Sequence length 283
Comment 2-hydroxy-6-oxo-2,4-heptadienoate hydrolase [Novosphingobium pentaromativorans US6-1 plasmid pLA1]
Sequence
MTAVAIDIARPEIGKSVTVDGSVTNYHDVGDGAPVLLIHGSGPGVTAWANWRLNMPELAK
RFRVIAPDMFGFGYSDSKGRIEDKRVWVDQVASLLDGLGIDKVSMVGNSFGGGITLAFMI
AHPDRVERAVLMGPAGLDFPITPALDLVWGYQPSLEEMRASLKYLAWDHSRLTEDLVQSR
YEASARPEAHEPYYATFGGFDRQANIAMLASREEDVAALQHETLILHGLFDQVIPLDSTV
RLASLLPRADLHVFAECGHWVQIERMASFNRMVTEFFENGLNA
Download sequence
Identical sequences A0A031J7H4 A0A0G3XN58 G6EL51
WP_007015978.1.54870 WP_007015978.1.63206 WP_007015978.1.71494 WP_007015978.1.95032 gi|494073921|ref|WP_007015978.1|NZ_AGFM01000122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]