SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|499314131|ref|WP_011004906.1|NZ_CM002756 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|499314131|ref|WP_011004906.1|NZ_CM002756
Domain Number 1 Region: 10-46,86-150
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000000111
Family Bacterial lipase 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|499314131|ref|WP_011004906.1|NZ_CM002756
Sequence length 151
Comment hypothetical protein [Ralstonia solanacearum Rs-10-244 plasmid unnamed1]
Sequence
MAERLGPLHAIIGHAFGAGNTIYSRRVHGFPVARMALLGGFSDGEWIIDRFAGLLHIPAA
ATRQMKSIHEARHHGKIRWSDFKLARMLGEASIPILLVHDRKDMEIPDVHAEAFQRESAG
RIPLLTTEGLGHRKIVRNPDVIARVCDFLEA
Download sequence
Identical sequences Q8XPH9
gi|17549880|ref|NP_523220.1| gi|17549880|ref|NP_523220.1|NC_003296 gi|499314131|ref|WP_011004906.1|NZ_CM002756 267608.RS02220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]