SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|507519133|ref|YP_008040748.1|NC_021289 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507519133|ref|YP_008040748.1|NC_021289
Domain Number 1 Region: 3-272
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.74e-67
Family Haloperoxidase 0.0000000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|507519133|ref|YP_008040748.1|NC_021289
Sequence length 273
Comment alpha/beta hydrolase fold [Burkholderia sp. RPE64 plasmid p1]
Sequence
MATFTLKDGTELFYKDWGTGPAVVFSHGWPLNADAWDSQMMYLAERGYRVIAHDRRGHGR
SSQPWQGNDMSRYADDLAELVDHLDVKDAVFVGHSTGGGEVARYIGRHGTKRVRKAVLIS
AVPPLMLKTEANPGGLPISVFDDIRRGVIENRSQFFKDLATPFFGFNREGAKPSQGTIDW
FWLAGMQCSIKSSYDCIKAFSETDFTEDLKKMTVPTLVLQGDADQIVPIDDSGKLSSKIV
PDGSLTIIPGAPHGMCTTHADTVNQHLFDFIQQ
Download sequence
Identical sequences R4WT98
WP_016348482.1.24340 gi|507519133|ref|YP_008040748.1|NC_021289 gi|507519133|ref|YP_008040748.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]