SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|525712188|ref|YP_008238452.1|NC_021745 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525712188|ref|YP_008238452.1|NC_021745
Domain Number 1 Region: 17-265
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.19e-40
Family Carbon-carbon bond hydrolase 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|525712188|ref|YP_008238452.1|NC_021745
Sequence length 272
Comment putative hydrolase [Ralstonia solanacearum FQY_4 plasmid megaplasmid]
Sequence
MHAQGEFANMRLPLVVDGAALDIAAIHRPGDRPPILFLHGFGSTKEDYADIVRHPAFDGR
PFVAYDAPGCGETACADLSRISIPFLVKTAEAVLDHFGWRTFHLVGHSMGGLTALMLASR
WPDRVLSFTDIEGNIAPEDCFLSRQIVSDPEADAERFFDAFIERTRHAPAYASALYAASL
RHKVRAGAVRGIFESMVDLSDNGGLMDRFLGLPCPRLFMYGEQNASLSYLRHIQAHGVAL
AEIPACGHFPMYSNPVLMWERIARFQAHAGAA
Download sequence
Identical sequences M4UPV4
WP_020830352.1.10616 WP_020830352.1.65509 WP_020830352.1.87978 gi|525712188|ref|YP_008238452.1|NC_021745 gi|525712188|ref|YP_008238452.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]