SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|528832544|ref|YP_008367343.1|NC_021908 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|528832544|ref|YP_008367343.1|NC_021908
Domain Number 1 Region: 1-259
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.11e-62
Family Biotin biosynthesis protein BioH 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|528832544|ref|YP_008367343.1|NC_021908
Sequence length 269
Comment 3-oxoadipate enol-lactonase [Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d]
Sequence
MQFARINDVTIHYQVIGAPADRPVIVFINSLGTDFRIWRDVVVRLAGDYAMVLYDKRGHG
LSDVGQLPSSIEDHATDLAGLLDLLSVKDAVILGLSVGGLIAQSLHQRRPDLVRALILSN
TAHKIGTAESWNARIAAVEKDGIASIVDAIMERWFTPAFRRPENTAYSGYCNMLTRQPVG
GYIAACEAIRDADLTQAAKSIAVPTLCIVGDQDGSTPPDLVLSTARLIPGARYEVIPDCA
HIPCVEQPEALTAIIRAFLTSLPPGESSP
Download sequence
Identical sequences S5SB30
WP_020922966.1.76939 gi|528832544|ref|YP_008367343.1| gi|528832544|ref|YP_008367343.1|NC_021908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]