SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|529218550|ref|YP_008379356.1|NC_021976 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529218550|ref|YP_008379356.1|NC_021976
Domain Number 1 Region: 42-239
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.23e-17
Family Carboxylesterase/thioesterase 1 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|529218550|ref|YP_008379356.1|NC_021976
Sequence length 276
Comment hypothetical protein APA386B_1P11 [Acetobacter pasteurianus 386B plasmid Apa386Bp1]
Sequence
MLEYLYVFLVSIIFLIIPCTTAYARPEQSHAVSTIHSDINEQVYSIPFREAGYVRVLFCV
PATHRGTIIMFPGGSGDIGLGKNGVIRYDHNFVVRTRRLWNRQGYAVIISDTINHINLRG
QRSSATYAGLIQSIIAFAHEEATVPVFLFGTSQGAIAAVNGAAHAASGTIAGVVLSESVS
VMGGSKETVFSATPQKVTVPVLIVANQDDRCDAAPPQAAQQIASAMTASPEVRVFMVSGG
ITKSKKNCGSLTPHGYFGIENDVVDKVSAWLDAKSR
Download sequence
Identical sequences S6D890
gi|529218550|ref|YP_008379356.1| gi|529218550|ref|YP_008379356.1|NC_021976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]