SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|549707632|ref|YP_008633911.1|NC_022536 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549707632|ref|YP_008633911.1|NC_022536
Domain Number 1 Region: 32-129,158-255
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.4e-26
Family Hydroxynitrile lyase-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|549707632|ref|YP_008633911.1|NC_022536
Sequence length 261
Comment conserved exported protein of unknown function [Rhizobium sp. IRBG74 plasmid III]
Sequence
MIMNRRTFSTAMLAGAAASMLSTKGMAASAAGHPEKARNVVFVHGLFADGSCWSEVISRL
QPEGLNITSVQNPLTTLSESVAAAERVLARQDGPTVLVGHSFGGMIVTQAGMHPNVSALV
YVAARAPDANEDFGALAKTFPTPPASAGIVFDGEEGRLSEKAFLEDFAGDIPTARAKVLY
ATQYPFQKTLLSGKVTEAAWRHKLSYYAVSSEDRTINPDLQRFLAKRMDAKAIELKASHL
SLISHPDEVAELILEAAGQKA
Download sequence
Identical sequences U4Q3F5
WP_022557122.1.19567 WP_022557122.1.72007 gi|549707632|ref|YP_008633911.1|NC_022536 gi|549707632|ref|YP_008633911.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]