SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|549708041|ref|YP_008634320.1|NC_022536 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549708041|ref|YP_008634320.1|NC_022536
Domain Number 1 Region: 13-212
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 9.73e-31
Family Carbon-carbon bond hydrolase 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|549708041|ref|YP_008634320.1|NC_022536
Sequence length 215
Comment fragment of putative alpha/beta-Hydrolases superfamily (part 2) [Rhizobium sp. IRBG74 plasmid III]
Sequence
MTSTLMPRCSTTVAEALRLERYALWLHDYGSQIGLRHAIAHPERIAALIIQNGDIYEDVL
GPKYETIKAWWADKSPEKHRPLAEAVSEDGFREEFVGEVSEEVASLVPPDLWKLHWPLMD
TPTRKMVAVRLMEKLEENLDWFPRYQGYLREHRPPTLVVWGPQDGYMPEASAQAYRRDLP
DAELHILGEAGHWLLETHLEQALPLVRDFLARTFR
Download sequence
Identical sequences U4Q825
gi|549708041|ref|YP_008634320.1| gi|549708041|ref|YP_008634320.1|NC_022536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]