SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|556559852|ref|YP_008729277.1|NC_022654 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|556559852|ref|YP_008729277.1|NC_022654
Domain Number - Region: 6-80
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000918
Family Mycobacterial antigens 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|556559852|ref|YP_008729277.1|NC_022654
Sequence length 86
Comment hypothetical protein MKAN_29235 [Mycobacterium kansasii ATCC 12478 plasmid pMK12478]
Sequence
MHVPLLVDNDTRLWVYSPSTLTCSDPAAMIGHCDQAQGSNRSFYNHYRSAGGRNGHFDIA
QGGQHDWNSWAPQLAAMAPDMTATIR
Download sequence
Identical sequences U5X0L0
gi|556559852|ref|YP_008729277.1| gi|556559852|ref|YP_008729277.1|NC_022654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]