SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56709215|ref|YP_165261.1|NC_006569 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56709215|ref|YP_165261.1|NC_006569
Domain Number 1 Region: 1-257
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.59e-62
Family Haloperoxidase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56709215|ref|YP_165261.1|NC_006569
Sequence length 262
Comment 3-oxoadipate enol-lactone hydrolase [Ruegeria pomeroyi DSS-3 plasmid megaplasmid]
Sequence
MQIADLGDIKLHFRVDGDPDGAPVVFINSLGTDLRLWDPILPHLPAGLRLIRYDKRGHGL
SDAPEGPYAMGTLVRDAERLLDLLDIRDAAVVGLSIGGMIAQGLAVKRLDQVRALVLSNT
AAKIGTKEMWQQRIAAVTAGGIEALADTVMERWFSRGFRATPELALWRNMLVRQPVQGYA
GCSAAIAGTDFYTPTSGLRLPTLGIAGDEDGSTPPDLVRETVDLIPGSQFHLFRKAGHLP
CVEHPAAYAERLAQFLRDVGHF
Download sequence
Identical sequences Q5LKE7
gi|56709215|ref|YP_165261.1|NC_006569 246200.SPOA0434 gi|56709215|ref|YP_165261.1| WP_011242211.1.46818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]