SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|86360925|ref|YP_472812.1|NC_007766 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|86360925|ref|YP_472812.1|NC_007766
Domain Number 1 Region: 5-262
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.62e-61
Family Biotin biosynthesis protein BioH 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|86360925|ref|YP_472812.1|NC_007766
Sequence length 269
Comment 3-oxoadipate enol-lactone hydrolase/4-carboxymuconolactone decarboxylase [Rhizobium etli CFN 42 plasmid p42f]
Sequence
MAEAQRYTVGDVTLNYRIDGSGEPLVCIHGVGSYLEAWSGVVERLKDSFTILTFDLRGHG
QSSRVKGRYEIDDFVNEALALADKAGFSTFNLAGFSLGGLIAQRLALTHLDRLRKLVLLS
TVAGRTPDERTRVLERLAALRAGTPADHHNASLSRWLTEEFQENNPAVIARLRERDAEND
PDCYAAAYRVLAETDFGGFLDQIRCPTLIATGEEDAGSNPRMARYMHERIPGSTLSILPG
LRHSILIEAPETVANLIHGFLTREETNHG
Download sequence
Identical sequences Q2JZA1
gi|86360925|ref|YP_472812.1| 347834.RHE_PF00194 WP_011428502.1.62937 gi|86360925|ref|YP_472812.1|NC_007766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]