SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|86360998|ref|YP_472885.1|NC_007766 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|86360998|ref|YP_472885.1|NC_007766
Domain Number 1 Region: 4-285
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.14e-63
Family Epoxide hydrolase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|86360998|ref|YP_472885.1|NC_007766
Sequence length 287
Comment hydrolase [Rhizobium etli CFN 42 plasmid p42f]
Sequence
MFEGFSLEAVDVGPGSLRVRRGGSGPAVLLLHGHPRTHMTWGKVADLLSPDHTVVCPDLP
GFGRSYQPGDASDSRNSSKRAKAEAHIELMRRLGHENFAVVGHDRGSLTAFRMAMDHPDR
VRKLVIVDAIPVIEHLERADWKFARDWYHWFFFAQKERPERAISADPLAWYDKLSPALMG
PQAYEDLIDVIHDPHVIHGMIEDYRASLSIDHLHDGDDRAAGRKIICPMLCLWSLRDDME
QIYGDPVAIWRNWARDVRGFGIDSGHHVAEENPAALSQAIREFLENG
Download sequence
Identical sequences Q2JZ28
347834.RHE_PF00268 WP_011428575.1.62937 gi|86360998|ref|YP_472885.1| gi|86360998|ref|YP_472885.1|NC_007766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]