SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94312577|ref|YP_585786.1|NC_007974 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94312577|ref|YP_585786.1|NC_007974
Domain Number 1 Region: 5-233
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.48e-48
Family Dienelactone hydrolase 0.0000526
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94312577|ref|YP_585786.1|NC_007974
Sequence length 236
Comment carboxymethylenebutenolidase [Cupriavidus metallidurans CH34 plasmid megaplasmid]
Sequence
MTTNSRWIRIDTPDGSFDAYLSLPPAGKQPGNPGIVLIQEIFGVNEHIRSVADQYAADGY
VVLAPDVFWRTAPRVELGYSGKDWEEAMKLRQAVNLEEAVSDIGATAKALRAEIGASGKV
AAVGYCFGGLLSYMAAARGMVDAAVPYYGGGIQNNLKEAEALNVPVQFHYGALDAHIKPE
DVERVRQAVAGKRGVEVFVYDQADHGFNCWARGSYHQRSAALAHGRALTFLTNALS
Download sequence
Identical sequences Q1LH59
WP_011518172.1.12480 WP_011518172.1.25839 266264.Rmet_3645 gi|94312577|ref|YP_585786.1|NC_007974 gi|94312577|ref|YP_585786.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]