SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|99078540|ref|YP_611798.1|NC_008043 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|99078540|ref|YP_611798.1|NC_008043
Domain Number 1 Region: 1-257
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.46e-59
Family Epoxide hydrolase 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|99078540|ref|YP_611798.1|NC_008043
Sequence length 264
Comment 3-oxoadipate enol-lactonase [Ruegeria sp. TM1040 plasmid mega plasmid]
Sequence
MPLADLGDVQLNYRLIGPEDAPAVVFAHALGTDQTIWDKVLQRLPQNIRVLTFDLRGHGG
SSVPPAPYSMGNLIRDVERLMETCAIQDSLFVGLSIGGMIAQGLAVKRLDLVRALVLSNT
AAKIATPEIWTRRMDTLRRGGMPAISVDTLQRWFPRSAWKSDVYAATQTLLERTDVEGYL
GCCAAIAGTDFYTPTSGLRLPALGIAGTEDGSTPPDLVRETLDLIPGSQFTLLRRTGHVP
PIDQPEAFAERLTSFMKDTGHLAK
Download sequence
Identical sequences Q1GLD0
292414.TM1040_3567 gi|99078540|ref|YP_611798.1|NC_008043 WP_011537175.1.15988 gi|99078540|ref|YP_611798.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]