SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|91975359|ref|YP_568018.1| from Rhodopseudomonas palustris BisB5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91975359|ref|YP_568018.1|
Domain Number 1 Region: 8-257
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.01e-39
Family Aclacinomycin methylesterase RdmC 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|91975359|ref|YP_568018.1|
Sequence length 273
Comment alpha/beta hydrolase fold protein [Rhodopseudomonas palustris BisB5]
Sequence
MTSLLSSGHLTIADHQLEYRMIGPSPADSPTLVLLHEGLGSVGLWGDFPDRLAAATGAGV
FVYSRAGYGGSSPARLPRPLDYMHREALDVLPQLLDAIGFRRGLLVGHSDGASIATIYAG
GVPDHRIRGVTLIAPHFIVEDVSVESIAAIKTAYESTELRAKLARWHSDVDNAFYGWNGA
WLDPAFRAWDISDHLAYIRVPVQIVQGADDQYGTSRQIEIAEAECYCPVEPLIIPGAGHS
PHREAAEATLRAVADFADRILNGHGEAAHGQAA
Download sequence
Identical sequences Q13CS2
2005382858 316057.RPD_0879 gi|91975359|ref|YP_568018.1| WP_011501302.1.68018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]