SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 267608.RS02219 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267608.RS02219
Domain Number 1 Region: 20-47
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000822
Family Hypothetical protein TT1662 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 267608.RS02219
Sequence length 55
Comment (Ralstonia solanacearum)
Sequence
MGIVRLLVWLVHIASLGVFFLPVTPQLLGFAVVAFDAPGHGDSDGKQTDMIALPG
Download sequence
Identical sequences Q8XPI0
267608.RS02219 gi|17549879|ref|NP_523219.1|NC_003296 gi|17549879|ref|NP_523219.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]