SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395961.Cyan7425_5433 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395961.Cyan7425_5433
Domain Number 1 Region: 2-108
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.07e-21
Family Lipase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395961.Cyan7425_5433
Sequence length 132
Comment (Cyanothece PCC 7425)
Sequence
MVGNLYLPTSYQPGDKLPVIIVTGAWTTVKEQMPAVYAQRLADRGFAAFTFDFRYWGESG
GTPRQYESPTAKVQDIKNAVAFLQTLPVIDGDRIGGLGICASADYMAQAVVEVTFSCDGF
PLCIAESLSPFV
Download sequence
Identical sequences B8HZ42
gi|219883227|ref|YP_002478389.1|NC_011880 395961.Cyan7425_5433 gi|219883227|ref|YP_002478389.1| WP_015939483.1.77409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]