SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A014PX80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A014PX80
Domain Number 1 Region: 3-188
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 9.27e-19
Family Biotin biosynthesis protein BioH 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A014PX80
Sequence length 193
Comment (tr|A0A014PX80|A0A014PX80_9GAMM) Esterase {ECO:0000313|EMBL:EXU75547.1} KW=Complete proteome; Reference proteome OX=69222 OS=Erwinia mallotivora. GN=BG55_10260 OC=Erwiniaceae; Erwinia.
Sequence
MATLLYLHGFNSSPSSAKATLFRQWLTEHHPAIRLHVPQLPSFPGEAAMMLENIIMSSAG
EPLGIIGSSLGGYYATWLSQCFMLPAVVVNPAVRPFELLVDYLGENENPYTGQQYVLESR
HIYDLKVMQIDPLESPDLIWLLQQTGDEVLDYRQALAYYAACRQTVEEGGNHAYIGFERH
FSAIIDFLGFSGH
Download sequence
Identical sequences A0A014PX80
WP_034936937.1.3328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]