SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059WBJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059WBJ0
Domain Number 1 Region: 9-260
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.98e-56
Family Aclacinomycin methylesterase RdmC 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059WBJ0
Sequence length 275
Comment (tr|A0A059WBJ0|A0A059WBJ0_STRA9) 3-oxoadipate enol-lactone hydrolase {ECO:0000313|EMBL:AIA06748.1} KW=Complete proteome; Reference proteome OX=68570 OS=Streptomyces albulus. GN=DC74_6311 OC=Streptomyces.
Sequence
MTPPAAPALHHTVNGPLGAPPLVLGPSLGTALSLWDPQLPDLAHRFRVVRWDLPGHGGTS
LDALADPGTTTVPELAGLVLDLADTLGLDRFAYAGASLGGAVGAWLAAHHPYRIASLALV
CSSARFGEPAGWRDRAAQVRAEGTDAVADAAAGRWFTPAFAASPTATALVEALRRDVSPD
GYAACCDALAAFDLRSALPRITAPTLVVAGRADPATPPAHARELTDGIRDASLVELSGAA
HLAGVERPAEVLAALLAHLAPLHLAPLHTAPGTAL
Download sequence
Identical sequences A0A059WBJ0 X0MX68
WP_016578316.1.11189 WP_016578316.1.1222 WP_016578316.1.33444 WP_016578316.1.60932 WP_016578316.1.85733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]