SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A077L147 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077L147
Domain Number 1 Region: 16-242
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.78e-35
Family Carboxylesterase/lipase 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077L147
Sequence length 246
Comment (tr|A0A077L147|A0A077L147_ACIGI) Putative carboxylesterase {ECO:0000313|EMBL:BAP37616.1} OX=106649 OS=Acinetobacter guillouiae (Acinetobacter genomosp. 11). GN=AS4_26760 OC=Moraxellaceae; Acinetobacter.
Sequence
MLKLRQPKPLFLKASQQAVLLLHAYTSTIQDMKALAKFLHQHGYTCYAPSYAGHGLTIDE
FLDYTTADWWQDTYNAYQLLENQGYKHIAVIGVSLGAILSLKLTEHFPIDACISMSAPQD
RSVNDLFKRLEHYAEYLHQFQNSNVELDLKSLENKAAIQLQAFHEFVAATISNVSLIRAP
IFLLYGELDDAHYQSSAQTIYNYVKSTEKKIKSYPNTGHLMTLGKDQTQLFSDILDFLDQ
HHPIQP
Download sequence
Identical sequences A0A077L147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]