SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A2Y0U4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A2Y0U4
Domain Number 1 Region: 45-201
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000293
Family YdeN-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A2Y0U4
Sequence length 214
Comment (tr|A0A0A2Y0U4|A0A0A2Y0U4_9PAST) Uncharacterized protein {ECO:0000313|EMBL:KGQ38273.1} KW=Complete proteome OX=155515 OS=Gallibacterium genomosp. 1. GN=JP36_03810 OC=Pasteurellaceae; Gallibacterium.
Sequence
MKTEFIEQQGSNLILYFAGWGTPPSAVAHLQIPQNFDLLICYDYQDLQLQFDFSAYNDIY
LVAWSMGVWVAEQVLQNVAIHKAVAINGTSKPNDDLFGIPTDIFQGTLDNLNTTTRNKFE
RRMCQSRELLAQYQQLPDYRSLENIQRELSFLAQQIKQRPAVIFQWHQAWIATQDYIFPV
INQQTYWQPRCVIKRIEAGHYAFPYFQQWQQLWH
Download sequence
Identical sequences A0A0A2XDG5 A0A0A2Y0U4
WP_039136872.1.102049 WP_039136872.1.68378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]