SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0EWM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0EWM8
Domain Number 1 Region: 3-183
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.53e-18
Family Haloperoxidase 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D0EWM8
Sequence length 257
Comment (tr|A0A0D0EWM8|A0A0D0EWM8_9FLAO) Esterase {ECO:0000313|EMBL:KIO53368.1} KW=Complete proteome; Reference proteome OX=37752 OS=Flavobacterium hibernum. GN=IW18_08650 OC=Flavobacteriaceae; Flavobacterium.
Sequence
MTKILSQLLICLLLISCSNSKKTNSQISNNTYPVKLDTLELFDKSRNRKVPIAIFYPKTD
FKISNQQIIIFSHGYGENKGGDNMIYSYLTENLASKGYFVISIQHELPTDDLLAMEGDFK
VTRKPNWERGTDNILYVLNEYKIIKPELDFKHLTLIGHSNGGDMTALFATKYPKLVYKII
TMDNRRMPLPRFNQPKVYTLRSKNYSADEGVLPTEQEQKKYEMIVQLTPINHSDMDNDAT
IEERKIINTYIEKYLRE
Download sequence
Identical sequences A0A0D0EWM8
WP_041517193.1.30495 WP_041517193.1.86771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]