SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0UJ88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0UJ88
Domain Number 1 Region: 37-262
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.9e-36
Family Acylamino-acid-releasing enzyme, C-terminal donain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0UJ88
Sequence length 278
Comment (tr|A0A0E0UJ88|A0A0E0UJ88_SINMB) Uncharacterized protein {ECO:0000313|EMBL:AEG06744.1} KW=Complete proteome OX=698936 OS=Sinorhizobium meliloti (strain BL225C). GN=SinmeB_5492 OC=Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium.
Sequence
MNATKLLLILPLLAAFAYISLVGLTYLSQRALLYPGASATPAPERASWGQNASIQTPDGE
TLHGLYSRGEPGQPSVLFFLGNADRVSNYGFFAQALAARGIGLLALSYRGYPGSTGTPNE
HGLLIDGIAAFDWLAARSGNEIVVLGQSLGSGVAVDTAGQRPAVAVILVSAYLSVLSLAQ
TYYPFFPVALLTKDPFRSDLKIAGVRQPKLFIHGRHDTIIPLSSGEALYQIAPEPKQMLI
YDAGHNDLWDARMVDDIIRFVQSQKGGTAIPPPRTDRN
Download sequence
Identical sequences A0A0E0UJ88
gi|384531900|ref|YP_005717504.1|NC_017324 gi|407691495|ref|YP_006815079.1|NC_018683 gi|433616832|ref|YP_007193627.1|NC_019848 gi|407691495|ref|YP_006815079.1| gi|433616832|ref|YP_007193627.1| gi|384531900|ref|YP_005717504.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]