SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M3GR10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M3GR10
Domain Number 1 Region: 5-123
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 3.99e-25
Family Antibiotic resistance proteins 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M3GR10
Sequence length 128
Comment (tr|A0A0M3GR10|A0A0M3GR10_9RHIZ) Biphenyl-2,3-diol 1,2-dioxygenase {ECO:0000313|EMBL:KKZ88202.1} KW=Complete proteome OX=1128399 OS=Rhizobium phaseoli Ch24-10. GN=RPHASCH2410_CH08695 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MIRIDRLDHLVLTVADITATCDFYSRILGMSVETFAEGRKALKFGHQKINLHQAGQEFEP
KARNPIPGSGDLCFIAETPIADVITHLQASAIVIEEGPVERTGATGGLRSVYFRDPDGNL
IEVSNLID
Download sequence
Identical sequences A0A0M3GR10 A0A192T6D5 B3PZ83
gi|190890013|ref|YP_001976555.1| 491916.RHECIAT_CH0000383 WP_012482392.1.10944 WP_012482392.1.19349 WP_012482392.1.25642 WP_012482392.1.26360 WP_012482392.1.84722 WP_012482392.1.88425 WP_012482392.1.9020 WP_012482392.1.96076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]