SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W0VHP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W0VHP2
Domain Number 1 Region: 36-136
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.38e-23
Family Epoxide hydrolase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0W0VHP2
Sequence length 136
Comment (tr|A0A0W0VHP2|A0A0W0VHP2_9GAMM) Lipolytic protein {ECO:0000313|EMBL:KTD19531.1} KW=Complete proteome; Reference proteome OX=454 OS=Legionella israelensis. GN=Lisr_2093 OC=Legionellaceae; Legionella.
Sequence
MSEKGQLERERSLDLMNKGKFDFLIKLIFKNSIYDKEKHNVLLPLAQEMAQEVGVENYKN
QLNAILNKPDHSSLLSSIECPTLLIASKEDKVMPIERSEHMEKNIKRSELIYIEECGHMA
MLEQPDKINQILTDWL
Download sequence
Identical sequences A0A0W0VHP2 A0A1G5FFI1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]