SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A168FIT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A168FIT9
Domain Number 1 Region: 4-289
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.62e-36
Family Haloperoxidase 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A168FIT9
Sequence length 292
Comment (tr|A0A168FIT9|A0A168FIT9_CORDF) Uncharacterized protein {ECO:0000313|EMBL:OAA75245.1} KW=Complete proteome; Reference proteome OX=1081108 OS=Cordyceps confragosa RCEF 1005. GN=LEL_07233 OC=Cordyceps.
Sequence
MDQVFRLTDGRQLSYSVSAATDGIPLIFLHGTPGNKAVLPAFEAKCKSRGVKLITTDRAG
YGGSTRQKGRRVADVVDDIKQLTQHLSISKCLVAGWSGGGPHALACAARLPGCLAALLVA
SVGPSDADDLDFLSGQGEGNLQEFHAALQGEAKLREFCEAERPDMMGDAQSIMTAMASNL
PEVDKAAILRDPDFGNYLSQSFREGLQVNCDGWIDDDLAFLQPWGFDVGENKTHVLLYQG
RDDKMVPFAHGEWIAQHLPAGTAQVRLLEGQGHISIFLDHVDEMIDGLLKHC
Download sequence
Identical sequences A0A168FIT9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]