SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A192TFB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A192TFB3
Domain Number 1 Region: 10-304
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.32e-38
Family Haloperoxidase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A192TFB3
Sequence length 324
Comment (tr|A0A192TFB3|A0A192TFB3_9RHIZ) Lysophospholipase protein {ECO:0000313|EMBL:ANL92956.1} KW=Complete proteome OX=396 OS=Rhizobium phaseoli. GN=AMC80_CH03719 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MDQVLYSTPDNPAPENRTEGYFETHDGHQLRYAVFRSGGQVAKGTVVILHGRNEYIEKYF
ETIRDLTAKGLWVATFDLRGQGGSPRLMKRRNHGHIRRFADYEHDLDTFLEKVVLPDTRL
PFYLLAHSTGGLIALSAAPYLTTRIDRMVLSAPFIGLTGQAASPRVIRTLAGTLTALGLG
FLPLTSKLKEPDFSDNPLTSDEHRFDRNVAMMKAHPELTLGPPTARWLTEAFRTMDRVTS
PNHLFSITIPTIVIAPTRDGVVPYTAQERLSRYFRAGQLVPINGARHEIFQERDIYRAAA
LAAFHAFIPGSDAEENQDVAALGT
Download sequence
Identical sequences A0A072CG07 A0A0M3GPU7 A0A192TFB3 B3PZW4
491916.RHECIAT_CH0003826 WP_012485198.1.10944 WP_012485198.1.12474 WP_012485198.1.19349 WP_012485198.1.25642 WP_012485198.1.26360 WP_012485198.1.49700 WP_012485198.1.76514 WP_012485198.1.82165 WP_012485198.1.84722 WP_012485198.1.88425 WP_012485198.1.9020 WP_012485198.1.96076 gi|190893400|ref|YP_001979942.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]